PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_15996
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CO-like
Protein Properties Length: 429aa    MW: 47215.7 Da    PI: 7.2092
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_15996genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box193e-06444539
    zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                +C+ +++++   +C++++  lC +C  + H+       H++
  PEQU_15996  4 YCDFCGDQRSMVYCRSDSASLCLSCDRNVHSAnalsrrHSR 44
                7*****************************65677777766 PP

2zf-B_box19.42.2e-064688440
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                  C+++  ++++  C + +  lC++C  ++H++      H+ +
  PEQU_15996 46 LLCDRCYLQPATVRCIEESISLCHNCDWNGHSSftsasgHKKQ 88
                57*****************************778888888866 PP

3CCT62.11.8e-21375418144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 R +a++RYkeK+k RkFeKkirY+sRKa+A+ R RvKGrFvk+ 
  PEQU_15996 375 RGNAVMRYKEKKKARKFEKKIRYASRKARADIRRRVKGRFVKAG 418
                 7789*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.968147IPR000315B-box-type zinc finger
SMARTSM003362.2E-10147IPR000315B-box-type zinc finger
CDDcd000217.44E-7447No hitNo description
PROSITE profilePS501198.5464390IPR000315B-box-type zinc finger
CDDcd000210.008924777No hitNo description
PfamPF062034.9E-16375417IPR010402CCT domain
PROSITE profilePS5101715.229375417IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MGSYCDFCGD QRSMVYCRSD SASLCLSCDR NVHSANALSR RHSRTLLCDR CYLQPATVRC  60
IEESISLCHN CDWNGHSSFT SASGHKKQTI TCYSGCPSAA ELANLWSFVS EFPPMADSSC  120
EQGMGLMSIN ENSASTYWGP LPNSCNADID NISKINNLEN QNKQNFHIGS ATSSPTPMIC  180
SADQEAGSVD STPPEKKTSY RIMRGIHASL KAMRENHKKP SNAGMKDTEN DKDGFYNGFS  240
GNVDLSFENY EEYFGTSHTH AEKLFDDVGI DSFFEMESSA ANSNCQGEFA AEAKSLHTTC  300
SNAVSADSVM STPVAKANSS VLVPARQAHS IPAYPFLFLS SVGDYQECGV SPMLLVGETQ  360
WYAPGPESSI KAANRGNAVM RYKEKKKARK FEKKIRYASR KARADIRRRV KGRFVKAGEA  420
YDYDPLCQT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008803173.11e-176PREDICTED: zinc finger protein CONSTANS-LIKE 10 isoform X2
TrEMBLM9QR190.0M9QR19_9ASPA; CONSTANS-like 8
STRINGGSMUA_Achr7P20150_0011e-148(Musa acuminata)
STRINGGSMUA_Achr9P12860_0011e-148(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20793788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-100CONSTANS-like 9